Acidic Fibroblast Growth Factor(aFGF), GR002

이전 상품 다음 상품
상세설명 상품후기(0) 교환 및 반품/배송/결제
  • 제품 설명서
  • MSDS

Acidic Fibroblast Growth Factor (aFGF)
recombinant, Human
expressed in E.Coli

Catalog Number
GR 002-010 (10ug)
GR 002-050 (50ug)
GR 002-200 (200ug)

Storage Temperature -5 ~ -20°C

Precautions
For In Vitro Use Only

 

Product Description

Acidic Fibroblast Growth Factor (aFGF), Fibroblast Growth Factor 1 (FGF-1), is a non-glycosylated 17-18 kDa protein consisting of a 155 amino acid polypeptide and a member of the fibroblast growth factor family of proteins. The function of aFGF is to promote cell proliferation, differentiation, and migration which is mediated by binding to the FGF receptor (FGFR) on the surface of cells, leading to the activation of intracellular signaling pathways that regulate various cellular processes.

aFGF is involved in various physiological and pathological processes, such as wound healing, angiogenesis, and cancer. In wound healing, aFGF stimulates the growth and migration of fibroblasts, which are essential for tissue repair. In angiogenesis, aFGF promotes the growth and differentiation of blood vessels, which is important for tissue development and repair.

In cancer, aFGF has been found to be overexpressed in various types of tumors, where it promotes cell proliferation, angiogenesis, and metastasis. As a result, aFGF has been identified as a potential target for cancer therapy.

In addition, aFGF has been used in medical treatments for various conditions, such as chronic wounds, ulcers, and ischemic heart disease. It has also been used in some cosmetic products for its potential skin-regenerating effects.

 

Product Information

Alternative Names :
Fibroblast growth factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
Species : Human
Source : E. Coli
Predicted Molecular Mass : 15.8 kDa
Amino Acid Sequence :
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Formulation :
Lyophilized from a sterile-filtered aqueous solution containing 20mM Sodium Phosphate, pH 6.0.


Product Specifications

Biological activity :
The EC50 ≤ 1.0 ng/mL as determined by a cell proliferation assay using BALB/ 3T3 cells.
Purity :
≥ 95% purity by SDS-PAGE
Endotoxin :
≤ 0.5 EU/mg protein by LAL(Limulus amebocyte lysate) analysis method.

 

Preparation and Storage

Storage :
Store at -5 °C to -20 °C.
Stability :
Stable as supplied for 12 months from date of receipt.
Preparation :
Centrifuge vial before opening. Reconstitute the product in sterile water to at least 0.1 mg/mL by pipetting the solution down the sides of the vial. Do not vortex

 

DATA

(A) The biological activity of Human Recombinant aFGF was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum. The EC50 in the under example is 0.68 ng/mL.
(B) Human Recombinant aFGF was resolved with SDS-PAGE under and visualized by Coomassie Blue staining. Human Recombinant aFGF has a predicted molecular mass of 15.8 kDa.

 

 

    상품정보고시
    제품명 Acidic Fibroblast Growth Factor(aFGF), GR002
    판매가격 가격문의
    관련상품
    위 상품과 관련된 상품이 없습니다.
    상세설명 상품후기(0) 교환 및 반품/배송/결제
    ※ 포토상품평
    번호 제목 이름 별점 날짜
    아직 작성된 상품평이 없습니다.
     
    ※ 일반상품평
    번호 제목 이름 별점 날짜
    아직 작성된 상품평이 없습니다.
     
    상세설명 상품후기(0) 교환 및 반품/배송/결제
    반품교환
    구입제품의 이상이 있는 경우
    - 제품에 이상이 있는 경우 본사 메일(wg@clearlab.com)로 해당 내용 정리하여 보내주시면 순차적으로 처리드리겠습니다.
    - 제품 이상이 확인될 경우 동일 제품으로 교환 가능 합니다.

    제품 이상이 아닌 단순변심으로 반품, 교환을 원하는 경우
    - 제품 출고일로부터 실온,냉장 2주 / 냉동 1주 이내 미개봉 제품에 한해 교환, 반품이 가능합니다.
    - 단순 변심의 경우 반품 배송비는 고객 부담입니다.(딜러고객)

    환불안내
    환불을 원하실 경우, 반품 제품 회수 및 검수 후 구매 금액을 환불해 드립니다.
    카드 결제 건의 경우, 승인 취소 처리되며 카드사 규정에 따라 환불까지 3~7일(영업일 기준) 정도 소요될 수 있습니다.

    √주의사항
    이미 개봉 된 제품이거나 실링 포장 및 라벨의 폐기 또는 훼손 등으로 제품이 손상 된 경우 반품 및 교환이 불가 합니다.
    주문 건에 사은품이 포함되어 있을 경우 함께 반품해 주셔야 합니다.
    냉장제품은 아이스팩 / 냉동제품은 드라이아이스 필히 동봉하여 반송 부탁 드립니다.

    ※반송주소 : 경상북도 경산시 남천면 남천로 693 웰진 출고부 허기태 부장 앞(우편번호:38695) T.053-811-7081
    배송안내
    재고가 있는 제품은 결제 후 2~3일 이내 CJ대한통운 택배로 안전하게 배송 됩니다.(주말,공휴일 제외)
    - 월~목) 주문마감은 1시이며, 1시30분까지 결제한 주문 건에 한해서 당일 출고 됩니다.
    - 냉장, 냉동 제품의 경우 목요일 1시30분 이후 결제된 주문 건은 차주 월요일에 출고 됩니다.
    - 금) 주문마감은 1시이며, 1시30분까지 결제한 주문 건에 한해서 상온제품만 출고 가능합니다.
    - 월요일 또는 공휴일 다음날은 출고물량 초과로 마감시간이 임의조정될 수 있습니다.
    - 일반고객(유저)도 결제확인 후 출고 됩니다. (입금or카드결제 처리 되어야 함)

    재고가 없는 제품은 생산 진행이 필요하며 출고 일정 확인 후 별도로 안내 드리고 있습니다.

    출고 후 홈페이지>마이페이지 에서 배송 조회 가능합니다.
    - 제주도를 포함한 도서,산간지역의 경우 기존 배송료에서 3,000원의 추가 배송료가 부과되며, 지역 택배사 사정에 따라 일정이 더 소요될 수 있습니다.
    - 긴급 택배나 퀵 서비스 요청 시 비용은 고객 부담이며 직접 진행해주시면 됩니다.

    √직배송 요청 방법(딜러전용)
    - 직배송의 경우, 주소 등록 시 '받으시는분'란을 '성함(직)' 으로 기재 부탁 드립니다. *예시 : 홍길동(직)
    - 미기재 시 '거래명세서'가 동봉되어 출고 되며 이에 대해 발생하는 문제는 웰진과 무관한 점 유의하시길 바랍니다.
    결제안내
    신용카드 / 무통장입금(세금계산서필수) 결제 가능합니다.
    - 무통장 입금시에는 결제 단계 페이지에서 계좌번호를 선택하시고 결제 마치시면 됩니다.
    - 입금자와 주문자명(업체명)을 동일하게 진행 부탁드립니다.
    - 입금자를 찾지 못하는 경우에는 입금확인이 지연 될 수 있습니다.
    - 카드영수증은 가입시 개인정보에 기입 된 메일로 발송되며 견적서 및 거래명세서는 홈페이지에서 확인,다운 가능합니다.