Insulin-like Growth Factor-1 (IGF-1) (GR005)

이전 상품 다음 상품
상세설명 상품후기(0) 교환 및 반품/배송/결제
  • 제품 설명서
  • MSDS

Stable-Basic Fibroblast Growth factor
recombinant, Human
expressed in E.Coli

Catalog Number
GR 005-010 (10ug)
GR 005-050 (50ug)
GR 005-200 (200ug)

Storage Temperature -5 ~ -20°C

Precautions
For In Vitro Use Only

 

Product Description

Insulin-like Growth Factor-1 (IGF-1) is a hormone consisting of 70 amino acids showing a similar molecular structure to insulin and plays a crucial role in growth and development. It is mainly produced by the liver, but also by other tissues, including muscles, bones, and cartilage.

The primary function of IGF-1 is to promote cell growth and division, particularly in bone, muscle, and cartilage tissues. IGF-1 plays roles by binding to the IGF-1 receptor (IGF-1R) on the surface of cells, which triggers a cascade of signaling events that activate various intracellular pathways, such as the PI3K/AKT and MAPK/ERK pathways. These pathways regulate cellular processes such as protein synthesis, cell proliferation, and differentiation.

IGF-1 is regulated by growth hormone (GH), which is produced by the pituitary gland. GH stimulates the liver to produce IGF-1, which is released into the bloodstream and circulates to target tissues.

 

Product Information

Alternative Names :
Insulin like growth factor 1, IGF1, IGF-I, IGF1A, IGFI, MGF, IGF
Species : Human
Source : E. Coli
Predicted Molecular Mass : 7.7 kDa
Amino Acid Sequence :
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA
Formulation :
Lyophilized from a sterile-filtered aqueous solution containing 20mM Sodium Phosphate, pH 7.0.

 

Product Specifications

Biological activity :
The EC50 ≤ 2.0 ng/mL as determined by a cell proliferation assay using BALB/ 3T3 cells.
Purity :
≥ 95% purity by SDS-PAGE
Endotoxin :
≤ 0.5 EU/mg protein by LAL(Limulus amebocyte lysate) analysis method.

 

Preparation and Storage

Storage :
Store at -5 °C to -20 °C.
Stability :
Stable as supplied for 12 months from date of receipt.
Preparation :
Centrifuge vial before opening. Reconstitute the product in sterile water to at least 0.1 mg/mL by pipetting the solution down the sides of the vial. Do not vortex

 

DATA

(A) The biological activity of Human Recombinant IGF-1 was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum. The EC50 in the under example is 1.85 ng/mL.
(B) Human Recombinant IGF-1  was resolved with SDS-PAGE under and visualized by Coomassie Blue staining. Human Recombinant IGF-1  has a predicted molecular mass of 7.7 kDa.

 

 

    상품정보고시
    제품명 Insulin-like Growth Factor-1 (IGF-1) (GR005)
    판매가격 가격문의
    관련상품
    위 상품과 관련된 상품이 없습니다.
    상세설명 상품후기(0) 교환 및 반품/배송/결제
    ※ 포토상품평
    번호 제목 이름 별점 날짜
    아직 작성된 상품평이 없습니다.
     
    ※ 일반상품평
    번호 제목 이름 별점 날짜
    아직 작성된 상품평이 없습니다.
     
    상세설명 상품후기(0) 교환 및 반품/배송/결제
    반품교환
    구입제품의 이상이 있는 경우
    - 제품에 이상이 있는 경우 본사 메일(wg@clearlab.com)로 해당 내용 정리하여 보내주시면 순차적으로 처리드리겠습니다.
    - 제품에 이상이 있는 경우 동일 제품으로 교환 가능 합니다.

    제품 이상이 아닌 단순변심으로 반품, 교환을 원하는 경우
    - 제품 출고일로부터 실온,냉장 2주 / 냉동 1주 이내 미개봉 제품에 한해 교환, 반품이 가능합니다.

    √주의사항
    이미 개봉 된 제품이거나 실링 포장 및 라벨의 폐기 또는 훼손 등으로 제품이 손상 된 경우 반품 및 교환이 불가 합니다.
    주문 건에 사은품이 포함되어 있을 경우 함께 반품해 주셔야 합니다.
    냉장제품은 아이스팩 / 냉동제품은 드라이아이스 필히 동봉하여 반송 부탁 드립니다.

    ※반송주소 : 경상북도 경산시 남천면 남천로 693 웰진 출고부 허기태 부장 앞(우편번호:38695) T.053-811-7081
    배송안내
    재고가 있는 제품은 결제 후 2~3일 이내 CJ대한통운 택배로 안전하게 배송 됩니다.(주말,공휴일 제외)
    - 월~목) 주문마감은 1시이며, 1시30분까지 결제한 주문 건에 한해서 당일 출고 됩니다.
    - 냉장, 냉동 제품의 경우 목요일 1시30분 이후 결제된 주문 건은 차주 월요일에 출고 됩니다.
    - 금) 주문마감은 1시이며, 1시30분까지 결제한 주문 건에 한해서 상온제품만 출고 가능합니다.
    - 월요일 또는 공휴일 다음날은 출고물량 초과로 마감시간이 임의조정될 수 있습니다.

    재고가 없는 제품은 생산 진행이 필요하며 출고 일정 확인 후 별도로 안내 드리고 있습니다.

    출고 후 홈페이지>마이페이지 에서 배송 조회 가능합니다.
    - 제주도를 포함한 도서,산간지역의 경우나 지역 택배사 사정에 따라 일정이 더 소요될 수 있습니다.
    - 긴급 택배나 퀵 서비스 요청 시 비용은 고객 부담이며 직접 진행해주시면 됩니다.

    √직배송 요청 방법(딜러전용)
    - 직배송의 경우, 주소 등록 시 '받으시는분'란을 '성함(직)' 으로 기재 부탁 드립니다. *예시 : 홍길동(직)
    - 미기재 시 '거래명세서'가 동봉되어 출고 되며 이에 대해 발생하는 문제는 웰진과 무관한 점 유의하시길 바랍니다.
    결제안내
    신용카드 / 무통장입금(세금계산서필수) 결제 가능합니다.
    - 무통장 입금시에는 결제 단계 페이지에서 계좌번호를 선택하시고 결제 마치시면 됩니다.
    - 입금자와 주문자명(업체명)을 동일하게 진행 부탁드립니다.
    - 입금자를 찾지 못하는 경우에는 입금확인이 지연 될 수 있습니다.
    - 카드영수증은 가입시 개인정보에 기입 된 메일로 발송되며 견적서 및 거래명세서는 홈페이지에서 확인,다운 가능합니다.