![Basic Fibroblast Growth Factor (bFGF) (GR003)](http://www.welgene.com/cdn/shop/files/GR003_new_{width}x.jpg?v=1716276105)
Basic Fibroblast Growth Factor (bFGF) (GR003)
냉장, 냉동 제품은 금요일에는 발송이 불가능하며, 차주 월요일에 발송됩니다.
재고 소진 시 배송이 지연 될 수 있습니다.(제품마다 생산소요기간 상이)
제품 설명서 (PDF 파일 다운로드) | MSDS (PDF 파일 다운로드) |
Basic Fibroblast Growth Factor (bFGF)
recombinant, Human
expressed in E.Coli
Catalog Number
GR 003-010 (10ug)
GR 003-050 (50ug)
GR 003-200 (200ug)
Storage Temperature -5 ~ -20°C
Precautions
For In Vitro Use Only
Product Description
Fibroblast Growth Factor, basic (syn.; FGF-2; HBGF-2) is 55% homology to FGF acidic and prototypic member of the fibroblast growth factor family. Fibroblast growth factor 2, also known as basic fibroblast growth factor (bFGF) and FGF-β, is a growth factor and signaling protein encoded by the FGF2 gene. It binds to specific fibroblast growth factor receptor (FGFR) proteins, a family of closely related molecules, and through them has a wide range of mitotic and cell survival activities, exerting a variety of biological effects including cell proliferation, differentiation, survival and apoptosis.
It supports the maintenance of undifferentiated human pluripotent stem cells, stimulates human pluripotent stem cells to form neural rosettes, and improves proliferation of human mesenchymal stem cells and enhances chondrogenic differentiation. Also it supports the maintenance of undifferentiated human pluripotent stem cells, stimulates human pluripotent stem cells to form neural rosettes, and improves proliferation of human mesenchymal stem cells and enhances chondrogenic differentiation
Product Information
Alternative Names :
Basic fibroblast growth factor, bFGF, FGF-β, FGF2, HBGF-2
Species : Human
Source : E. Coli
Predicted Molecular Mass : 16.4 kDa
Amino Acid Sequence :
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Formulation :
Lyophilized from a sterile-filtered aqueous solution containing 20mM Sodium Phosphate, pH 7.0
Product Specifications
Biological activity :
The EC50 ≤ 2.0 ng/mL as determined by a cell proliferation assay using BALB/ 3T3 cells.
Purity :
≥ 95% purity by SDS-PAGE
Endotoxin :
≤ 0.5 EU/mg protein by LAL(Limulus amebocyte lysate) analysis method.
Preparation and Storage
Storage :
Store at -5 °C to -20 °C.
Stability :
Stable as supplied for 12 months from date of receipt.
Preparation :
Centrifuge vial before opening. Reconstitute the product in sterile water to at least 0.1 mg/mL by pipetting the solution down the sides of the vial. Do not vortex
DATA
(A) The biological activity of Human Recombinant bFGF was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum. The EC50 in the under example is 1.33 ng/mL.
(B) Human Recombinant bFGF was resolved with SDS-PAGE under and visualized by Coomassie Blue staining. Human Recombinant bFGF has a predicted molecular mass of 16.4 kDa.