Platelet-derived growth factor-BB (PDGF-BB) (GR006)
냉장, 냉동 제품은 금요일에는 발송이 불가능하며, 차주 월요일에 발송됩니다.
재고 소진 시 배송이 지연 될 수 있습니다.(제품마다 생산소요기간 상이)
제품 설명서 (PDF 파일 다운로드) | MSDS (PDF 파일 다운로드) |
Stable-Basic Fibroblast Growth factor
recombinant, Human
expressed in E.Coli
Catalog Number
GR 006-010 (10ug)
GR 006-050 (50ug)
GR 006-200 (200ug)
Storage Temperature -5 ~ -20°C
Precautions
For In Vitro Use Only
Product Description
Platelet-derived growth factor (PDGF) is a dimeric molecule that exists as a homodimer or as a heterodimer of the polypeptide chains. And these polypeptide chains are linked by disulfide bonds. PDGF is expressed in five forms: PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD. Platelet-Derived Growth Factor BB (PDGF-BB) is a member of the platelet-derived growth factor family and plays a crucial role in regulating cell growth, proliferation, and differentiation in various tissues.
PDGF-BB is primarily produced by platelets, endothelial cells, and smooth muscle cells and plays roles by binding to the PDGF receptor (PDGFR) on the surface of cells, leading to the activation of intracellular signaling pathways that regulate various cellular processes.
The main function of PDGF-BB is to stimulate the growth and division of mesenchymal cells, including fibroblasts and smooth muscle cells. It is involved in various physiological and pathological processes, such as wound healing, tissue repair, and cancer. In wound healing and tissue repair, PDGF-BB stimulates the growth and migration of fibroblasts, which are essential for the formation of granulation tissue and extracellular matrix. PDGF-BB has also been used in medical treatments for various conditions, such as chronic wounds, ulcers, and bone fractures. It has been shown to have potential therapeutic applications in the promotion of tissue regeneration and healing. In cancer, PDGF-BB has been found to be overexpressed in various types of tumors, where it promotes cell proliferation, angiogenesis, and metastasis.
Product Information
Alternative Names :
Platelet-Derived Growth Factor-BB, Glioma-derived growth factor (GDGF), Osteosarcoma-derived Growth Factor (ODGF)
Species : Human
Source : Pichia
Predicted Molecular Mass : 24.6kDa
Amino Acid Sequence :
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Formulation :
Lyophilized from a sterile-filtered aqueous solution containing 20mM Sodium Phosphate, pH 7.0
Product Specifications
Biological activity :
The EC50 ≤ 5.0 ng/mL as determined by a cell proliferation assay using BALB/ 3T3 cells.
Purity :
≥ 95% purity by SDS-PAGE
Endotoxin :
≤ 0.5 EU/mg protein by LAL(Limulus amebocyte lysate) analysis method.
Preparation and Storage
Storage :
Store at -5 °C to -20 °C.
Stability :
Stable as supplied for 12 months from date of receipt.
Preparation :
Centrifuge vial before opening. Reconstitute the product in sterile water to at least 0.1 mg/mL by pipetting the solution down the sides of the vial. Do not vortex
DATA
(A) The biological activity of Human Recombinant PDGF-BB was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum. The EC50 in the under example is 4.44 ng/mL.
(B) Human Recombinant PDGF-BB was resolved with SDS-PAGE under and visualized by Coomassie Blue staining. Human Recombinant PDGF-BB has a predicted molecular mass of 24.6 kDa.